PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004512.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 678aa    MW: 74478 Da    PI: 5.1148
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004512.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS201.93.8e-622664351180
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+ L++cAeav++++++la+al++++  la +++ +m+++a++f+eALa+r+++    +y    p++    ++s + + +  f+e++P+lkf+h+ta
  Pbr004512.1 266 LVHGLMACAEAVQQNNFNLAKALVTQIGYLAGSQAGAMRKVATFFAEALAQRIFQ----VY----PQSPI--DHSFSDMLQMHFYETCPYLKFAHFTA 353
                  6899**************************************************9....44....33332..23444445556*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                  NqaIle+++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s++++ l+e+g++La++Ae+++v+fe++v
  Pbr004512.1 354 NQAILESLQGKTRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPSSDNSDHLQEVGWKLAQLAETIHVEFEYRV 435
                  ********************************************************************************86 PP

2GRAS2761.2e-84436668138374
         GRAS 138 gppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvks 233
                   pp +R+Tg+g+p+s++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ ++L+++p   E++aVn+v++lh+ll++++++e+    vL++vk+
  Pbr004512.1 436 APPAFRLTGIGPPASDNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSLADLDASMLELRPseVESVAVNSVFELHKLLARPGAIEK----VLSVVKQ 529
                  69***********************************************************88899*********************....******* PP

         GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                  ++P++v+vveqea+hn++ F++rf e+l+yys+lfdsle +   +++ ++++++++lg++i+nvvaceg +r+erhetl +Wr+r+++a F pv+l++
  Pbr004512.1 530 MKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGS---ANSRDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHLGS 624
                  ***************************************99...58999999********************************************** PP

         GRAS 332 kaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +a kqa++ll+ ++ +dgyrvee++g+++l W++rpL+++SaW+
  Pbr004512.1 625 NAFKQASMLLALFAgGDGYRVEENDGCMMLAWHTRPLIATSAWK 668
                  *******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120413.6E-3350117IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011295.2E-3250123No hitNo description
PROSITE profilePS5098563.432240647IPR005202Transcription factor GRAS
PfamPF035141.3E-59266435IPR005202Transcription factor GRAS
PfamPF035144.1E-82436668IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MKGEHQTHQL NQYPPPQHPD PSMASTSAGG GFGKAKMWED ESHRIDGGMD ELLAVLGYKV  60
WSSNMAEVAQ KLEQLEEFMG CAQEDGLSQL ASDTVHYNPA DLSTWLESMI SEINLPPPNF  120
DPLMGGAVAG MQPNQQQVQL VDDPFLARGE SSITTVDFPD QRKSKSISTS PPQTVFEDCN  180
SSSSYYDFKS IPGNAVFTQT RLDSPSREPK RLKSSSGSSP SELLFNRPAA SSLPQPQQPI  240
SLPATAESSP TRPALIVDSQ ENGVRLVHGL MACAEAVQQN NFNLAKALVT QIGYLAGSQA  300
GAMRKVATFF AEALAQRIFQ VYPQSPIDHS FSDMLQMHFY ETCPYLKFAH FTANQAILES  360
LQGKTRVHVI DFSMNQGMQW PALMQALALR PGGPPAFRLT GIGPPSSDNS DHLQEVGWKL  420
AQLAETIHVE FEYRVAPPAF RLTGIGPPAS DNSDHLQEVG WKLAQLAETI HVEFEYRGFV  480
ANSLADLDAS MLELRPSEVE SVAVNSVFEL HKLLARPGAI EKVLSVVKQM KPEIVTVVEQ  540
EANHNGPVFM DRFNESLHYY STLFDSLEGS ANSRDKVMSE VYLGKQICNV VACEGVDRVE  600
RHETLTQWRA RFGSADFVPV HLGSNAFKQA SMLLALFAGG DGYRVEENDG CMMLAWHTRP  660
LIATSAWKPA YNSVMAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-462666684375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF3041030.0JF304103.1 Pyrus x bretschneideri cultivar Yali DELLA protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349514.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLI1ZG120.0I1ZG12_9R
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein